Products

APRIL (A proliferation-inducing ligand), Human

APRIL (A PRoliferation-Inducing Ligand) is a member of the tumor necrosis factor family. APRIL shows high levels of expression in tumors of different origin and low level of expression in normal cells. APRIL shares two TNF receptor family members, TACI and BCMA (or another TNF homolog, BlyS/BAFF) have been reported to play a role in autoimmune disease and cancer. The protein encoded by this gene is a member of the tumor necrosis factor ligand (TNF) ligand family. This protein is a ligand for TNFRSF17/BCMA, a member of the TNF receptor family. This protein and its receptor are both found to be important for B cell development. In vivo experiments suggest an important role for APRIL in the long-term survival of plasma cells in the bone marrow. Mice deficient in APRIL have normal immune system development. However, APRIL-deficient mice have also been reported to possess a reduced ability to support plasma cell survival. In vitro experiments suggested that this protein may be able to induce apoptosis through its interaction with other TNF receptor family proteins such as TNFRSF6/FAS and TNFRSF14/HVEM. Three alternatively spliced transcript variants of this gene encoding distinct isoforms have been reported. 
No. Size Price Qty Status
C01049-20UG 20 ug $268.00 Inquiry
C01049-100UG 100 ug $528.00 Inquiry
The price does not include shipping fee and tax. Order Request Quote
Sequence: 
MAVLTQKQKKQHSVLHLVPINATSKDDSDVTEVMWQPALRRGRGLQAQGYGVRIQDAGVYLLYSQVLFQDVTFTMGQVVSREGQGRQE
TLFRCIRSMPSHPDRAYNSCYSAGVFHLHQGDILSVIIPRARAKLNLSPHGTFLGFVKL with polyhistidine tag at the C-terminus
 
Source:

Escherichia coli

Endotoxin Test:
<0.1 EU per 1 μg of the protein by the LAL method.

Activity:
Measured by its ability to induce cell death in Jurkat cells. The ED50 for this effect is 2.6-4.0 μg/mL.
 
Purity:
>98% as determined by SDS-PAGE. 

Form:
Lyophilized

Storage Buffer:
Lyophilized from a 0.2 μm filtered solution of PBS, pH 8.0.

Reconstitution:
It is recommended to reconstitute the lyophilized protein in sterile H₂O to a concentration not less than 200 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.

Stability & Storage:
This product is stable after storage at:
• -20°C for 12 months in lyophilized state from date of receipt.
• -20°C or -80°C for 1 month under sterile conditions after reconstitution.
Avoid repeated freeze/thaw cycles.
Reviews for APRIL (A proliferation-inducing ligand), Human

Average Rating: 0 (0 Reviews )